<\/p>\n
LL-37 5mg is a highly specialised antimicrobial peptide from the cathelicidin family, researched for its broad-spectrum activity against bacteria, viruses, and fungi. By mimicking innate immune responses, LL-37 supports studies on membrane disruption, immune modulation, and wound healing processes. Its amphipathic alpha-helical structure makes it a key compound for investigators exploring host defence mechanisms and anti-infective strategies.<\/p>\n","protected":false},"excerpt":{"rendered":"
<\/p>\n
LL-37 5mg is a highly specialised antimicrobial peptide from the cathelicidin family, researched for its broad-spectrum activity against bacteria, viruses, and fungi. By mimicking innate immune responses, LL-37 supports studies on membrane disruption, immune modulation, and wound healing processes. Its amphipathic alpha-helical structure makes it a key compound for investigators exploring host defence mechanisms and anti-infective strategies.<\/p>\n
LL-37 5mg is frequently examined in models of microbial infection, inflammation, or tissue repair. Its 37-amino-acid sequence enables rapid interaction with lipid membranes, making it suitable for research into antimicrobial resistance, angiogenesis promotion, and chemokine induction under stress conditions. Due to its multifunctional properties, LL-37 is often selected for studies on epithelial barrier function, endotoxin neutralisation, and immune cell recruitment in various disease contexts.<\/p>\n
Antimicrobial Action \u2013 Targets microbial membranes to support studies on bacterial killing and biofilm disruption<\/p>\n<\/li>\n
Immune Modulation \u2013 Used to examine chemokine release, angiogenesis, and wound repair mechanisms<\/p>\n<\/li>\n
Multifunctional peptide \u2013 Enables research into inflammation control, viral inhibition, and cellular signalling<\/p>\n<\/li>\n
Research Only \u2013 Intended for qualified professionals conducting advanced scientific investigation<\/p>\n<\/li>\n<\/ul>\n
<\/p>\n
<\/p>\n
\nLL-37 5mg<\/h5>\n<\/td>\nCAS Number<\/strong><\/td>\n | 154947-66-7<\/strong><\/td>\n<\/tr>\n | Molar Mass<\/strong><\/td>\n | 4493 g\/mol<\/strong><\/td>\n<\/tr>\n | Molecular Formula<\/strong><\/td>\n | C<sub>205<\/sub>H<sub>340<\/sub>N<sub>60<\/sub>O<sub>53<\/sub><\/strong><\/td>\n<\/tr>\n | Sequence<\/strong><\/td>\n | [LL-37, 37 aa]<\/strong><\/td>\n<\/tr>\n<\/tbody>\n<\/table>\n | \n ⚠️ Research Use Only Disclaimer<\/h3>\nAll products featured on this site are intended solely for research purposes<\/strong> and are not for human or veterinary consumption<\/strong> under any circumstances. These materials are not classified as drugs, food products, cosmetics, or medicinal items.<\/p>\n By purchasing, the buyer accepts full responsibility for the safe handling, storage, and use of the compound, and confirms that they are a qualified professional conducting legitimate scientific work. Neither the distributor, manufacturer, nor seller shall be held liable for any misuse or outcome related to the use of this research material.<\/p>\n By completing your order, you confirm that:<\/p>\n |