Viser 97–107 af 107 resultaterSorteret efter popularitet

NaCl (0,9% saltvandsopløsning) – 5 ml til injektion og næsespray
Læg i kurv

NaCl (0,9% saltvandsopløsning) – 5 ml til injektion og næsespray

5.99 €

NaCl (0.9% Saline Solution) – 5ml (Sterile for Injection Use)

Description:
Our NaCl (0.9% Saline Solution) is a sterile, non-pyrogenic preparation of water containing 0.9% sodium chloride, meticulously formulated to mirror the body’s natural fluid balance.
Produced to strict pharmaceutical-grade standards, this solution is specifically intended for injectable use and nasal spray formulations, making it the ideal choice for the reconstitution of peptides, biologicals, and other sensitive compounds where absolute sterility is critical.

Available in both 5ml and 20ml vial formats, this product offers flexibility depending on your volume needs — whether for smaller, single-use preparations or larger-scale reconstitutions.

Key Features:

  • Pharmaceutical-grade sterility for safe injectable and nasal spray use.

  • Isotonic formulation to ensure maximum tissue compatibility and minimise irritation.

  • Preservative-free; single-use recommended to maintain absolute sterility.

  • Choice of 5ml or 20ml vial sizes to suit research, clinical, or wellness requirements.

Technical Specifications:

  • Volume Options: 5ml or 20ml per vial

  • Composition: Sterile water with 0.9% sodium chloride

  • Shelf Life After Opening: Immediate use recommended

Important Hygiene Note:
Once opened, vials cannot be resealed or stored for later use.
To maintain full sterility and hygiene standards, any unused solution should be discarded immediately after opening.

Intended Use:
Injectable preparation, peptide reconstitution, nasal spray formulations, laboratory, research, and professional medical applications.

Important Considerations:
For research protocols, nasal sprays, or clinical use requiring ongoing withdrawals over several days, we recommend using Bacteriostatic Water (0.9% Benzyl Alcohol Solution) instead, as it contains a preservative to inhibit bacterial growth and maintain sterility over multiple doses.

G³-Next-Generation Triple-Agonist Peptide 20mg
Læg i kurv

G³-Next-Generation Triple-Agonist Peptide 20mg

199.00 €
Advanced Laboratory Research

Next-Generation Triple-Agonist Peptide

An investigational synthetic peptide developed for scientific examination of multi-receptor signaling, metabolic regulation, and systemic energy balance across GIP, GLP-1, and glucagon receptor pathways.

Product Specifications

Classification

Investigational, single-molecule triple-hormone receptor agonist (GIP, GLP-1, and glucagon receptor co-agonist).

Molecular Structure

Lipidated 39-amino-acid synthetic peptide sequence engineered with specialized stabilizing residues.

Research Focus

In-vitro and in-vivo evaluation of metabolic regulation, systemic energy balance, and multi-receptor signaling pathways.

Clinical Stage

The reference investigational compound has undergone Phase III clinical evaluation. Current trial status should be verified against official clinical trial records. This does not establish clinical authorization for the research material described here.

Key Research Characteristics

01 Multi-Receptor Engagement

Simultaneously targets glucagon-like peptide-1 (GLP-1), glucose-dependent insulinotropic polypeptide (GIP), and glucagon receptors to investigate synergistic metabolic responses.

02 Metabolic & Glycemic Profiling

Designed for scientific exploration of glucose homeostasis, lipid metabolism, and energy expenditure modulation.

03 Regulatory Status

Intended strictly for laboratory, biochemical, and authorized nonclinical research applications.
This research material is not approved for human or veterinary therapeutic use.

Handling, Storage & Stability

Form
Lyophilized powder.
Short-Term Storage
Store at 2–8°C (36–46°F) for short periods, typically several weeks, subject to product-specific stability data.
Long-Term Storage
Store at -20°C (-4°F) to -80°C (-112°F), tightly sealed, desiccated, and protected from moisture and light. Storage for up to 3 years may be possible when supported by product-specific stability testing.
Temperature Management
Minimize temperature fluctuations and repeated freeze-thaw cycles to help preserve peptide integrity.
Reconstitution
Allow the sealed vial to reach room temperature before opening to minimize condensation. Reconstitute only with a validated diluent appropriate to the research protocol. Avoid vigorous agitation or vortexing.
Storage After Reconstitution
Store according to validated solution stability data. Refrigeration at 2–8°C (36–46°F) may be appropriate for certain formulations, but storage duration must be established for the specific peptide, diluent, and concentration.

Laboratory Use & Compliance Agreement

Research Use Only Disclaimer

This product is intended strictly for in-vitro laboratory research, biochemical testing, and authorized laboratory animal experimentation. It is not intended for human or veterinary consumption, clinical diagnostics, or therapeutic applications.

Terms of Purchase

By purchasing or utilizing this material, the buyer acknowledges and agrees that:

  1. The product will be handled exclusively by qualified laboratory personnel trained in the safe handling of investigational peptides.
  2. The buyer is responsible for appropriate handling, storage, experimental procedures, and compliance with applicable laws and institutional safety requirements.
  3. This product is not an approved drug, food product, or medical device and must not be administered to human subjects.
  4. All research activities must comply with applicable institutional, ethical, and regulatory requirements.
  5. Product stability, purity, identity, and expiration claims must be supported by appropriate analytical documentation and
    product-specific testing.
FOR LABORATORY RESEARCH USE ONLY — NOT FOR HUMAN OR VETERINARY USE
KPV 10 mg
Læg i kurv

KPV 10 mg

52.99 €

KPV 10 mg 

What is KPV 10mg?

KPV 5mg is a tripeptide fragment (Lys-Pro-Val) derived from the larger α-MSH peptide. It has gained increasing interest in research for its notable anti-inflammatory, gut-protective, and skin-modulating properties. Researchers value KPV for its ability to influence pathways associated with inflammation, immune balance, and epithelial repair.

Key Benefits and Applications of KPV 10mg:

Anti-Inflammatory Activity

KPV is widely recognised for its strong anti-inflammatory potential. Research indicates that it can reduce inflammatory cytokines and calm localised tissue irritation, making it a valuable peptide for studies involving inflammation-driven conditions.

Gut Barrier Protection

One of the most studied areas for KPV is its effect on the intestinal lining. It may help support epithelial integrity, tighten the gut barrier, and modulate inflammatory processes within the gastrointestinal tract. This makes it highly relevant for research on gut inflammation and barrier dysfunction.

Skin Healing & Epithelial Support

KPV has shown promise in research relating to skin repair, wound healing, and irritation reduction. It may support healthier epithelial responses and aid in recovery from surface-level inflammation.

Immune Modulation

Emerging data suggests that KPV may help modulate immune activity, supporting balanced immune responses and reducing unnecessary inflammatory signalling.

Anti-Microbial Potential

Some studies indicate that KPV may demonstrate antimicrobial effects against certain bacteria, adding further interest for researchers investigating protective or restorative mechanisms.

How Does KPV Work?

KPV interacts with melanocortin receptors and inflammatory signalling pathways. It is believed to reduce pro-inflammatory cytokines, support epithelial cell stability, and improve tissue recovery responses. These mechanisms make KPV a compelling candidate for research on inflammation, gut health, immune modulation, and epithelial repair.

KPV 10 mg

CAS Number

67727-97-3
Molar Mass  341.4 g/mol
Molecular Formula  C₁₇H₃₀N₆O₄
Sequence
 Lys-Pro-Val

⚠️ Research Use Only Disclaimer

All products featured on this site are intended solely for research purposes and are not for human or veterinary consumption under any circumstances. These materials are not classified as drugs, food products, cosmetics, or medicinal items.

By purchasing, the buyer accepts full responsibility for the safe handling, storage, and use of the compound, and confirms that they are a qualified professional conducting legitimate scientific work. Neither the distributor, manufacturer, nor seller shall be held liable for any misuse or outcome related to the use of this research material.

By completing your order, you confirm that:

  • You are over 18

  • You understand and accept our [Terms & Conditions]

  • You agree to handle all products in compliance with all applicable laws and safety standards.

 

Pinealon 10mg
Læg i kurv

Pinealon 10mg

59.99 €

Pinealon 10mg

Pinealon 10mg is a synthetic tripeptide composed of three amino acids: glutamic acid, aspartic acid and arginine. It is commonly identified by the abbreviated sequence Glu-Asp-Arg (EDR).

Pinealon has been investigated within peptide biology and molecular research, particularly in experimental models involving cellular signalling, oxidative processes and regulation of gene and protein expression.

Its relatively simple three-amino-acid structure distinguishes Pinealon from larger peptide compounds and has made it a subject of scientific investigation into how short regulatory peptides may interact with cellular and molecular systems.

Published laboratory research has examined Pinealon in cultured cellular models exposed to experimentally induced oxidative stress. Other investigations have explored the EDR peptide in relation to molecular mechanisms associated with gene expression and protein synthesis.

These characteristics make Pinealon of interest for controlled laboratory research involving short-peptide biology, cellular signalling, molecular regulation and comparative peptide analysis.

This preparation contains 10 mg of lyophilised Pinealon supplied exclusively as a laboratory research material.

LABORATORY RESEARCH CHEMICAL ONLY

Strictly for in vitro laboratory research by qualified professionals.

NOT FOR HUMAN OR ANIMAL USE.

NOT FOR MEDICAL, THERAPEUTIC, DIAGNOSTIC OR CONSUMPTION PURPOSES.

No dosing, administration, reconstitution or clinical-use guidance is provided.

 

This preparation contains 10 mg of lyophilised Pinealon supplied exclusively as a laboratory research material.

LABORATORY RESEARCH CHEMICAL ONLY

Strictly for in vitro laboratory research by qualified professionals.

NOT FOR HUMAN OR ANIMAL USE.

NOT FOR MEDICAL, THERAPEUTIC, DIAGNOSTIC OR CONSUMPTION PURPOSES.

No dosing, administration, reconstitution or clinical-use guidance is provided.

 

Pinealon 10mg
CAS Number 175175-23-2
Molar Mass 418.40 g/mol
Molecular Formula C₁₅H₂₆N₆O₈
Sequence H-Glu-Asp-Arg-OH

Important Reminder:
Before reconstitution, ensure both the peptide and bacteriostatic mixing water are at room temperature to support proper dissolution and avoid destabilising the compound.
Bacteriostatic mixing water sold separately.

Ansvarsfraskrivelse

All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise.

The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Vilkår og betingelser and acknowledge that you will abide by these terms.

G³-Next-Generation Triple-Agonist Peptide 30mg
Læg i kurv

G³-Next-Generation Triple-Agonist Peptide 30mg

279.00 €
Advanced Laboratory Research

Next-Generation Triple-Agonist Peptide

An investigational synthetic peptide developed for scientific examination of multi-receptor signaling, metabolic regulation, and systemic energy balance across GIP, GLP-1, and glucagon receptor pathways.

Product Specifications

Classification

Investigational, single-molecule triple-hormone receptor agonist (GIP, GLP-1, and glucagon receptor co-agonist).

Molecular Structure

Lipidated 39-amino-acid synthetic peptide sequence engineered with specialized stabilizing residues.

Research Focus

In-vitro and in-vivo evaluation of metabolic regulation, systemic energy balance, and multi-receptor signaling pathways.

Clinical Stage

The reference investigational compound has undergone Phase III clinical evaluation. Current trial status should be verified against official clinical trial records. This does not establish clinical authorization for the research material described here.

Key Research Characteristics

01 Multi-Receptor Engagement

Simultaneously targets glucagon-like peptide-1 (GLP-1), glucose-dependent insulinotropic polypeptide (GIP), and glucagon receptors to investigate synergistic metabolic responses.

02 Metabolic & Glycemic Profiling

Designed for scientific exploration of glucose homeostasis, lipid metabolism, and energy expenditure modulation.

03 Regulatory Status

Intended strictly for laboratory, biochemical, and authorized nonclinical research applications.
This research material is not approved for human or veterinary therapeutic use.

Handling, Storage & Stability

Form
Lyophilized powder.
Short-Term Storage
Store at 2–8°C (36–46°F) for short periods, typically several weeks, subject to product-specific stability data.
Long-Term Storage
Store at -20°C (-4°F) to -80°C (-112°F), tightly sealed, desiccated, and protected from moisture and light. Storage for up to 3 years may be possible when supported by product-specific stability testing.
Temperature Management
Minimize temperature fluctuations and repeated freeze-thaw cycles to help preserve peptide integrity.
Reconstitution
Allow the sealed vial to reach room temperature before opening to minimize condensation. Reconstitute only with a validated diluent appropriate to the research protocol. Avoid vigorous agitation or vortexing.
Storage After Reconstitution
Store according to validated solution stability data. Refrigeration at 2–8°C (36–46°F) may be appropriate for certain formulations, but storage duration must be established for the specific peptide, diluent, and concentration.

Laboratory Use & Compliance Agreement

Research Use Only Disclaimer

This product is intended strictly for in-vitro laboratory research, biochemical testing, and authorized laboratory animal experimentation. It is not intended for human or veterinary consumption, clinical diagnostics, or therapeutic applications.

Terms of Purchase

By purchasing or utilizing this material, the buyer acknowledges and agrees that:

  1. The product will be handled exclusively by qualified laboratory personnel trained in the safe handling of investigational peptides.
  2. The buyer is responsible for appropriate handling, storage, experimental procedures, and compliance with applicable laws and institutional safety requirements.
  3. This product is not an approved drug, food product, or medical device and must not be administered to human subjects.
  4. All research activities must comply with applicable institutional, ethical, and regulatory requirements.
  5. Product stability, purity, identity, and expiration claims must be supported by appropriate analytical documentation and
    product-specific testing.
FOR LABORATORY RESEARCH USE ONLY — NOT FOR HUMAN OR VETERINARY USE
GHRP-2 næsespray 5 mg
Læg i kurv

GHRP-2 næsespray 5 mg

44.99 €

GHRP-2 Nasal spray 5mg

 

Each nasal spray comes complete with everything you need for immediate use, including a glass nasal sprayer and sterile bacteriostatic water to reconstitute the lyophilised peptide and keep it fresh for your research. Once reconstituted, the solution should be stored refrigerated and is typically suitable for research use for up to 30 days.
If you are making multiple purchases, you may not need a spray bottle with every vial. In this case, please feel free to contact us at info@researchpeptideseurope.com, and we will be glad to assist you.

 

 

 

What is GHRP-2?

 

GHRP-2, also known as Pralmorelin, is a growth hormone-releasing peptide that stimulates growth hormone (GH) production by activating the growth hormone secretagogue receptor. It also triggers ghrelin, a hormone that stimulates hunger and promotes stomach emptying. Research shows that GHRP-2 can significantly boost growth hormone levels by stimulating the pituitary gland and hypothalamus, leading to a 7 to 15-fold increase in GH secretion.

Benefits of GHRP-2

 

  • Fat Loss: GHRP-2 promotes fat reduction, particularly in the abdominal area, by stimulating lipolysis (the breakdown of stored fats into energy).
  • Weight Gain: Stimulates appetite, which can aid in healthy weight gain.
  • Muscle Mass: Supports muscle growth by boosting testosterone levels, countering age-related muscle decline.
  • Anti-Ageing: Enhances skin elasticity, reduces wrinkles, and improves hydration by boosting collagen production.
GHRP-2
CAS Number 158861-67-7
Molar Mass 817.97 g/mol
Chemical Formula C45H55N9O6
Sequence D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2

Disclaimer:

All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise.

The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Vilkår og betingelser and acknowledge that you will abide by these terms.

AHK-CU 100mg
Læg i kurv

AHK-CU 100mg

59.99 €

AHK-CU 100mg

AHK-Cu, also known as copper tripeptide AHK-Cu, is a synthetic peptide complex composed of the amino acids alanine, histidine, and lysine bound to copper ions. It has attracted scientific interest for its potential biological activity in hair follicle research, cellular signalling, and tissue regeneration.

Research suggests that AHK-Cu may influence processes associated with hair follicle development and growth. Laboratory studies have investigated its potential effects on dermal papilla cells, including cellular proliferation and signalling pathways involved in the regulation of the hair growth cycle.

Additionally, AHK-Cu has been explored for its potential role in extracellular matrix regulation and cellular repair mechanisms. As a copper-binding peptide, it is of interest in studies examining copper-dependent biological processes and the interaction between peptides and cellular activity.

Although preliminary laboratory findings have identified promising areas for further investigation, additional research is required to establish its biological mechanisms, safety profile, and potential applications.

AHK-CU
CAS Number
82775-79-5
Molar Mass
470.05 g/mol
Molecular Formula
C₁₈H₃₂CuN₈O₃
Sequence
Ala-His-Lys

Important Reminder:
Before reconstitution, ensure both the peptide and bacteriostatic mixing water are at room temperature to support proper dissolution and avoid destabilising the compound.
Bacteriostatic mixing water sold separately.

Disclaimer:

All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise.

The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Vilkår og betingelser and acknowledge that you will abide by these terms.

Fox04 10 mg 
Læg i kurv

Fox04 10 mg 

189.99 €

FOX04 10mg 

Fox04 is a synthetic peptide based on the forkhead box O4 transcription factor, a regulator involved in cell cycle control, stress response and longevity-associated pathways. It is studied for its role in cellular ageing processes, particularly in relation to senescence signalling and interactions with p53 and other intracellular targets.

This peptide is produced through controlled laboratory synthesis and is not naturally occurring in this form. Its use allows researchers to examine FOXO4-linked mechanisms in a defined, reproducible way, supporting projects focused on cellular stress, DNA damage responses and age-related changes in in-vitro tissue models.

Key Features Fox04 

  • FOXO4 Pathway Tool – Used to support studies involving Fox04 -mediated signalling

  • Cellular Ageing Insight – Suitable for research into senescence, stress responses and cell fate regulation

  • Mechanistic Studies – Selected for in-vitro work on transcription factor activity and downstream gene expression

  • High Research Purity – Supplied as a lyophilised solid for controlled laboratory use

  • Research Only – Intended for qualified professionals conducting scientific investigation

Research Context Fox04 

In experimental settings, FOXO4 is used to explore:

  • Cellular senescence and ageing-related signalling cascades

  • FOXO4 interactions with p53 and other nuclear factors

  • Oxidative and metabolic stress models in cultured cells

  • Regulation of apoptosis, cell cycle arrest and survival pathways

  • Transcriptional programmes linked to tissue homeostasis and functional decline

Its structured design makes it suitable for in-vitro studies where controlled modulation of FOXO4-related pathways is required, including comparative work alongside FOXO4-DRI and other senescence-focused tools.

Fox04 10 mg

CAS Number

Not officially assigned (research peptide)
Molar Mass 5358.05 g/mol
Molecular Formula C₂₂₈H₃₈₈N₈₆O₆₄
Chemical Name  FOXO4 peptide (Forkhead box protein O4-derived peptide)

⚠️ Research Use Only Disclaimer

All products featured on this site are intended solely for research purposes and are not for human or veterinary consumption under any circumstances. These materials are not classified as drugs, food products, cosmetics, or medicinal items.

By purchasing, the buyer accepts full responsibility for the safe handling, storage, and use of the compound, and confirms that they are a qualified professional conducting legitimate scientific work. Neither the distributor, manufacturer, nor seller shall be held liable for any misuse or outcome related to the use of this research material.

By completing your order, you confirm that:

  • You are over 18

  • You understand and accept our [Terms & Conditions]

  • You agree to handle all products in compliance with all applicable laws and safety standards.

 

VIP 10mg
Læg i kurv

VIP 10mg

59.99 €

VIP 10mg

VIP, short for Vasoactive Intestinal Peptide, is a naturally occurring 28-amino-acid neuropeptide that has been extensively studied in molecular biology, physiology and receptor pharmacology. Synthetic VIP is used experimentally to investigate the signalling mechanisms associated with this naturally occurring peptide.

First isolated in the early 1970s, VIP was initially identified in intestinal tissue but was subsequently found to have a much broader distribution throughout the nervous system and other tissues. These discoveries led to extensive scientific interest in its role as a signalling molecule.

VIP exerts its biological activity primarily through VPAC1 and VPAC2 receptors, members of the G-protein-coupled receptor family. Researchers have studied these receptor interactions to understand downstream signalling mechanisms, including pathways involving cyclic adenosine monophosphate (cAMP).

Published research involving VIP spans a broad range of biological systems. Experimental studies have investigated its involvement in neuropeptide signalling, vascular biology, smooth-muscle regulation, immune and inflammatory signalling, gastrointestinal physiology and cellular communication.

VIP is also of interest in neuroscience and molecular research because of its function as a neuropeptide and neurotransmitter/modulator. Laboratory models have been used to investigate how VIP-mediated signalling influences communication between cells and interacts with other regulatory pathways.

These characteristics have established VIP as an important research peptide for investigating receptor pharmacology, cellular signalling and the molecular mechanisms associated with neuropeptide activity.

This preparation contains 10 mg of lyophilised VIP supplied exclusively as a laboratory research material.

LABORATORY RESEARCH CHEMICAL ONLY

Strictly for in vitro laboratory research by qualified professionals.

NOT FOR HUMAN OR ANIMAL USE.

NOT FOR MEDICAL, THERAPEUTIC, DIAGNOSTIC OR CONSUMPTION PURPOSES.

No dosing, administration, reconstitution or clinical-use guidance is provided.

 

 

 

VIP 10mg
CAS Number 140077-57-4
Molar Mass 3325.8 g/mol
Molecular Formula C₁₄₇H₂₃₇N₄₃O₄₃S
Sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂

Important Reminder:
Before reconstitution, ensure both the peptide and bacteriostatic mixing water are at room temperature to support proper dissolution and avoid destabilising the compound.
Bacteriostatic mixing water sold separately.

Ansvarsfraskrivelse

All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise.

The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Vilkår og betingelser and acknowledge that you will abide by these terms.

Tesamorelin Nasal Spray 5mg
Læg i kurv

Tesamorelin Nasal Spray 5mg

69.99 €

Tesamorelin Nasal Spray 5mg

Each nasal spray comes complete with everything required for immediate research use, including a premium glass nasal sprayer and sterile bacteriostatic water for reconstituting the lyophilised peptide. Once mixed, the solution should be refrigerated and is typically suitable for research purposes for up to 30 days.

If purchasing multiple units, you may not require a spray bottle with every vial. In this case, please contact info@researchpeptideseurope.com and our team will be happy to assist you.

What is Tesamorelin?

Tesamorelin is a synthetic peptide analogue of growth hormone-releasing hormone (GHRH), developed to stimulate the natural release of growth hormone from the pituitary gland. By binding to GHRH receptors, Tesamorelin promotes increased secretion of growth hormone and IGF-1, making it an important subject of ongoing metabolic and endocrine research.

Originally developed by Theratechnologies, Tesamorelin gained attention for its role in studies involving HIV-associated lipodystrophy and visceral adipose tissue accumulation. Research suggests that Tesamorelin may influence body composition, fat metabolism, and growth hormone regulation.

Although Tesamorelin has been approved in specific clinical settings, research into alternative delivery methods such as intranasal administration continues to expand due to the convenience and potential absorption advantages offered by nasal delivery systems.

Clinical and preclinical investigations have explored Tesamorelin’s potential effects on visceral fat reduction, metabolic health, and growth hormone signalling pathways. Studies have demonstrated significant reductions in visceral adipose tissue (VAT) following extended administration periods.

 

 

Tesamorelin Nasal Spray
CAS Number 901758-09-6
Molar Mass 5146 g/mol
Molecular Formula C221H366N72O67S
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Gln-Ser-Asn-Gln-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2

 

Tesamorelin Overview

Tesamorelin is widely researched for its ability to stimulate endogenous growth hormone release while maintaining the body’s natural regulatory feedback mechanisms. Unlike direct growth hormone administration, Tesamorelin acts upstream through GHRH receptor activation, making it a valuable compound in peptide and metabolic research.

Current research continues to investigate Tesamorelin’s potential applications involving body composition, lipid metabolism, recovery pathways, and endocrine function.

https://pubmed.ncbi.nlm.nih.gov/28832410/

 

Disclaimer:

All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise.

The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Vilkår og betingelser and acknowledge that you will abide by these terms.

By completing your order, you confirm that:
• You are over 18
• You understand and accept our Terms & Conditions
• You agree to handle all products in compliance with all applicable laws and safety standards.